PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G107500.1
Common NamePHAVU_009G107500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CPP
Protein Properties Length: 504aa    MW: 56184.7 Da    PI: 8.627
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G107500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.76.3e-15130168241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++k+CnCk+s+Clk+YCeCfaag +C+  C+C +C+N+ +
  Phvul.009G107500.1 130 KQKQCNCKNSRCLKLYCECFAAGIYCDG-CNCVNCHNNVD 168
                         89**************************.********986 PP

2TCR51.22.5e-16212251140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Phvul.009G107500.1 212 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 251
                         589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.6E-18129169IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.157130252IPR005172CRC domain
PfamPF036385.6E-12131166IPR005172CRC domain
SMARTSM011148.4E-20212253IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.3E-13215250IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MEPSETASDS APRKLVRQLD FTLVHEDPPH LKLPPPSPPQ HSLLPPPSHS LLQLQLNLQS  60
PGQRPWLYSE PQEQQQQPWL HSPRPKLVSW VSRFPPVQKP PVKVLPVVKP DSPRSQPRFN  120
VESKDTNPKK QKQCNCKNSR CLKLYCECFA AGIYCDGCNC VNCHNNVDNE AARQEAVGIT  180
LERNPNAFRP KIASSPQEQR NSKENEAQVI GKHNKGCHCK KSGCLKKYCE CFQANILCSE  240
NCKCMDCKNF EGSTERRAIF HREYNQVHIK QGTSDAVTEV VGSSGYRNHI TPKRRKIQEM  300
FSGKATVDQT VNTTAQYLQA IDRMASPSSS LSDSFVFDQV NSRISGSSRS VLADVLQPQN  360
VKNLCSLFVI LARVAAKTNA ETREKIDRKT KAGNFKTSVA SSAKSPQETK DVRQPVCDDH  420
VNKAVADAVD IDNYNRPLSP ETLALMCDEQ DSMFFGNTSA DGASHKNIIQ KSLNSDYGEQ  480
ERLIMTKLLD VLRELVTLGS IKG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-149AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007137192.10.0hypothetical protein PHAVU_009G107500g
SwissprotQ9SZD11e-122TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV7AYA00.0V7AYA0_PHAVU; Uncharacterized protein
STRINGGLYMA04G08670.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151511113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-97Tesmin/TSO1-like CXC domain-containing protein